PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy009982
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 359aa    MW: 39426.5 Da    PI: 5.5422
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59555919PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS399.92.6e-122313571345
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                lv++L++cA+a+++++l la+ l+++ s las++g +m+++aa f  ALa+r+++       a+p ++ s ++ s+ l++   f+e++P+lkf+h+taNq
  Ahy009982  31 LVHALMACAQAIQEEKLDLADVLVNHASVLASQQGGAMRKVAANFSHALARRIYG-------AFPEESMS-SSLSDMLHV--HFYETCPYLKFAHFTANQ 120
                689****************************************************.......45544444.567777777..4***************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                aIlea++++++vH+iDf+++qGlQWpaL+qaLa Rp+gpps+R+Tg+g+ +++++++l+++g+rL+++A++++v+fef+ + +++l+dl++ +L++kpgE
  Ahy009982 121 AILEAFSSATAVHVIDFGLKQGLQWPALMQALALRPGGPPSFRLTGIGPTSPEDTDTLQQVGWRLSQLARTIQVRFEFRGFGCNSLSDLDPTALDIKPGE 220
                ***************************************************9************************************************ PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                ++aVn v++lhr+l++++sle     vL++vk+++P++v+vveqea+hn++ F+erf+ea++yys+lfds+e ++    +e+ ++++++lgr+i+nvvac
  Ahy009982 221 SVAVNAVFELHRMLAKPGSLER----VLNTVKNIEPEIVTVVEQEANHNGPVFFERFTEAMHYYSSLFDSMEGSV----NEDGTLSEVYLGRQICNVVAC 312
                **********************....************************************************6....9999***************** PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                eg++r+erhetl++Wr r+++aGF+p++l+++a  qa++ll+ ++
  Ahy009982 313 EGEDRVERHETLAQWRVRMGSAGFEPIRLGSNAFRQARMLLALFA 357
                *****************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.3915359IPR005202Transcription factor GRAS
PfamPF035149.0E-12031357IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
XAVTETVKSQ VEPHSDLTCH CVAVEDTGVR LVHALMACAQ AIQEEKLDLA DVLVNHASVL  60
ASQQGGAMRK VAANFSHALA RRIYGAFPEE SMSSSLSDML HVHFYETCPY LKFAHFTANQ  120
AILEAFSSAT AVHVIDFGLK QGLQWPALMQ ALALRPGGPP SFRLTGIGPT SPEDTDTLQQ  180
VGWRLSQLAR TIQVRFEFRG FGCNSLSDLD PTALDIKPGE SVAVNAVFEL HRMLAKPGSL  240
ERVLNTVKNI EPEIVTVVEQ EANHNGPVFF ERFTEAMHYY SSLFDSMEGS VNEDGTLSEV  300
YLGRQICNVV ACEGEDRVER HETLAQWRVR MGSAGFEPIR LGSNAFRQAR MLLALFAGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-53313534340GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016167698.10.0PREDICTED: DELLA protein GAI
SwissprotQ7Y1B61e-178GAI_SOLLC; DELLA protein GAI
TrEMBLA5HVE50.0A5HVE5_PHAVU; DELLA protein
TrEMBLV7D2D10.0V7D2D1_PHAVU; Uncharacterized protein
STRINGGLYMA18G04500.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-160RGA-like 1